MK50H27TQ33B
- Artikelnummer:
- MK50H27TQ33B
- Hersteller:
- STMicroelectronics
- Beschreibung:
- IC CTRLR SYSTEM7 33MHZ 52-PLCC
- RoHS-Status:
- Bleifrei / RoHS-konform
- Menge auf Lager:
- 52201 Pieces
- Lieferzeit:
- 1-2 days (We have stocks to ship now)
- Produktionszeit:
- 4-8 weeks
- Datenblatt:
- MK50H27TQ33B.pdf
Einführung
We can supply MK50H27TQ33B, use the request quote form to request MK50H27TQ33B pirce and lead time.XXX.com a professional electronic components distributor. With 3+ Million line items of available electronic components can ship in short lead-time, over 250 thousand part numbers of electronic components in stock for immediately delivery, which may include part number MK50H27TQ33B.The price and lead time for MK50H27TQ33B depending on the quantity required, availability and warehouse location.Contact us today and our sales representative will provide you price and delivery on Part# MK50H27TQ33B.We look forward to working with you to establish long-term relations of cooperation
Spezifikation
| Interne Teilenummer | RO-MK50H27TQ33B |
|---|---|
| Bedingung | Original New |
| Herkunftsland | Contact us |
| Top-Markierung | email us |
| Ersatz | See datasheet |
| Spannungsversorgung: | - |
| Supplier Device-Gehäuse: | 52-PLCC |
| Serie: | - |
| Leistung (W): | 500mW |
| Verpackung: | Tape & Reel (TR) |
| Verpackung / Gehäuse: | 52-LCC (J-Lead) |
| Betriebstemperatur: | 0°C ~ 70°C |
| Zahl der Schaltkreise: | 1 |
| Befestigungsart: | Surface Mount |
| Feuchtigkeitsempfindlichkeitsniveau (MSL): | 3 (168 Hours) |
| Bleifreier Status / RoHS-Status: | Lead free / RoHS Compliant |
| Schnittstelle: | HDLC, SS7 |
| Enthält: | Error Recovery and Monitoring, Link Status Control, Sequence Number Control, Signal Unit Formatting and Generation |
| Funktion: | Signaling System 7 Link Controller |
| detaillierte Beschreibung: | Telecom IC Signaling System 7 Link Controller 52-PLCC |
| Strom - Versorgung: | - |
| Basisteilenummer: | MK50H27 |
| Email: | [email protected] |
In Verbindung stehende Teile für MK50H27TQ33B
läst Nachrichten
- Der hohe Schalter des Halbleiter -Doppelkanals bringt mehr Flexibilität in das Design des Kapazitätslastantriebs
- ST Halbleiter startet die dritte Generation Produkte Siliziumkarbid die zukünftige Entwicklung von Elektrofahrzeugen und industriellen Anwendungen zu fördern.
- Die führenden STM32-Mikrocontroller im Halbleitermarkt beschleunigen drahtlose Produktentwicklung bis